(data stored in ACNUC7421 zone)

EMBL: AL009126.YCBM

AL009126.YCBM        Location/Qualifiers
FT   CDS             279059..279994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbM"
FT                   /locus_tag="BSU_02560"
FT                   /old_locus_tag="BSU02560"
FT                   /product="two-component sensor histidine kinase [YcbL]"
FT                   /function="16.3: Control"
FT                   /function="16.12: Sense"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295; Product type rc:
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02560"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12050"
FT                   /db_xref="GOA:P42245"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG11168"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42245"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295"
FT                   /protein_id="CAB12050.2"
FT                   /translation="MTVLWVAAVIALACLNVIQFIMKKKRDGNLAYTADQLSYMLSRDS
FT                   AGQILLPTDDHALKDLLVNINLIVENRQQISAQFAKTEQSMKRMLTNMSHDLKTPLTVI
FT                   LGYIEAIQSDPNMPDEERERLLGKLRQKTNELIQMINSFFDLAKLESEDKEIPITKVHM
FT                   NDICKRNILHYYDAVQSKGFQAAIDIPDTPVYAQANEEALDRILQNLLSNAIQYGAAGK
FT                   LIGLTLSYDERNIAITVWDRGKGISETDQQRVFERLYTLEESRNKAFQGSGLGLTITKR
FT                   LTEKMGGIISVQSKPYERTAFTITLKRMTY"
     MTVLWVAAVI ALACLNVIQF IMKKKRDGNL AYTADQLSYM LSRDSAGQIL LPTDDHALKD        60
     LLVNINLIVE NRQQISAQFA KTEQSMKRML TNMSHDLKTP LTVILGYIEA IQSDPNMPDE       120
     ERERLLGKLR QKTNELIQMI NSFFDLAKLE SEDKEIPITK VHMNDICKRN ILHYYDAVQS       180
     KGFQAAIDIP DTPVYAQANE EALDRILQNL LSNAIQYGAA GKLIGLTLSY DERNIAITVW       240
     DRGKGISETD QQRVFERLYT LEESRNKAFQ GSGLGLTITK RLTEKMGGII SVQSKPYERT       300
     AFTITLKRMT Y                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page