(data stored in SCRATCH zone)

EMBL: AL009126.YCBP

AL009126.YCBP        Location/Qualifiers
FT   CDS             complement(281769..282155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbP"
FT                   /locus_tag="BSU_02590"
FT                   /old_locus_tag="BSU02590"
FT                   /product="putative inner integral membrane protein"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406,
FT                   22582280; Product type m: membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02590"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12053"
FT                   /db_xref="GOA:P42248"
FT                   /db_xref="InterPro:IPR019649"
FT                   /db_xref="SubtiList:BG11171"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42248"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12053.1"
FT                   /translation="MTHVKALAIKGIMTIIVLYLVLGLGFGFTFGDTLLMTIVLGVISY
FT                   LLGDLYVLPKWNNMIATLADFGLAFLVIWLMGMPLSMGMTGGEVALAALFGAIVMAIGE
FT                   YCFHFYMMSKEIGKKHYLETRTDS"
     MTHVKALAIK GIMTIIVLYL VLGLGFGFTF GDTLLMTIVL GVISYLLGDL YVLPKWNNMI        60
     ATLADFGLAF LVIWLMGMPL SMGMTGGEVA LAALFGAIVM AIGEYCFHFY MMSKEIGKKH       120
     YLETRTDS                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page