(data stored in ACNUC7421 zone)

EMBL: AL009126.YCBR

AL009126.YCBR        Location/Qualifiers
FT   CDS             283003..283734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbR"
FT                   /locus_tag="BSU_02610"
FT                   /old_locus_tag="BSU02610"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02610"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12055"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR019303"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="SubtiList:BG11173"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42250"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12055.2"
FT                   /translation="MATIDLQKKSVKIVLEKKQLTKVTARVGLVLDITGSMRPLYKNGT
FT                   VQNVVERILAVADQFDDNGLLDVWVYDNEFSRLKPVSEKDFSGYVDREILNNDRLHKFG
FT                   RNDEPPVMKDVLRKYVTEEPSSYPAFIVFINDGGCKKSIKPIIEASSDKPVFWQFVGIG
FT                   NGNFDFLNKLDTLEGRVIDNTNFLHIEEIDRISDDELYDALLAEFPFWLKEAKEKGIVR
FT                   EQEPPAEKPKKKGFFSRLFSK"
     MATIDLQKKS VKIVLEKKQL TKVTARVGLV LDITGSMRPL YKNGTVQNVV ERILAVADQF        60
     DDNGLLDVWV YDNEFSRLKP VSEKDFSGYV DREILNNDRL HKFGRNDEPP VMKDVLRKYV       120
     TEEPSSYPAF IVFINDGGCK KSIKPIIEAS SDKPVFWQFV GIGNGNFDFL NKLDTLEGRV       180
     IDNTNFLHIE EIDRISDDEL YDALLAEFPF WLKEAKEKGI VREQEPPAEK PKKKGFFSRL       240
     FSK                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page