(data stored in ACNUC7421 zone)

EMBL: AL009126.YCBU

AL009126.YCBU        Location/Qualifiers
FT   CDS             287499..288611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbU"
FT                   /locus_tag="BSU_02660"
FT                   /old_locus_tag="BSU02660"
FT                   /product="putative lyase (PLP-dependent)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02660"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12060"
FT                   /db_xref="GOA:P42253"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="SubtiList:BG11176"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42253"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12060.2"
FT                   /translation="MEHLPEQYRQLFPTLQTHTMLASCSQSALAEPVSRAIQDYYDSLL
FT                   YKGTNWKEAIEKTEFARNEFAKLIGAEPDEVAIVPSVSDALVSVASSLTAFGKKHVVYT
FT                   DMDFPAVPHVWQAHSDYTVSVIPSIDGVLPLEQYETHISDETVLTCVPHVHYRDGYVQD
FT                   IKAIAEISQRKGSLLFVDAYQSAGHIPIDVKEWGVDMLAAGTRKYLLGIPGVAFLYVRK
FT                   ELADALKPKASAWFGRESGFDGAYAKVARRFQTGTPAFISVYAAAAALSLLNHIGVSHI
FT                   RDHVKTICADAVQYAAEKGLQLAAAQGGIQPGMVAIRDERASETAGLLKKKKVICAPRE
FT                   NVIRLAPHFYNTKEEMRHAIDEIAAKTIHK"
     MEHLPEQYRQ LFPTLQTHTM LASCSQSALA EPVSRAIQDY YDSLLYKGTN WKEAIEKTEF        60
     ARNEFAKLIG AEPDEVAIVP SVSDALVSVA SSLTAFGKKH VVYTDMDFPA VPHVWQAHSD       120
     YTVSVIPSID GVLPLEQYET HISDETVLTC VPHVHYRDGY VQDIKAIAEI SQRKGSLLFV       180
     DAYQSAGHIP IDVKEWGVDM LAAGTRKYLL GIPGVAFLYV RKELADALKP KASAWFGRES       240
     GFDGAYAKVA RRFQTGTPAF ISVYAAAAAL SLLNHIGVSH IRDHVKTICA DAVQYAAEKG       300
     LQLAAAQGGI QPGMVAIRDE RASETAGLLK KKKVICAPRE NVIRLAPHFY NTKEEMRHAI       360
     DEIAAKTIHK                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page