(data stored in SCRATCH zone)

EMBL: AL009126.YCCK

AL009126.YCCK        Location/Qualifiers
FT   CDS             298466..299398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccK"
FT                   /locus_tag="BSU_02770"
FT                   /old_locus_tag="BSU02770"
FT                   /product="putative ion channel associated aldo-keto
FT                   reductase"
FT                   /function="16.1: Circulate"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 17322186, 24330391;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02770"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12071"
FT                   /db_xref="GOA:P46905"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="SubtiList:BG11340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46905"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12071.1"
FT                   /translation="MDQTRTLGKTKLKVKRIGFGANAVGGHNLFPNLNDETGKDLVRTA
FT                   LDGGVNFIDTAFIYGLGRSEELIGEVVQERGVRNELIIATKGAHKEVDGSIELDNSREF
FT                   LRSEVEKSLKRLKTDYIDLYYVHFPDGKTPLAEVAGTLKELKDEGKIKAIGASNLDYQQ
FT                   LQDFNADGYLEVFQAEYSLIQRDAEKELLPYCEKQGISFIPYFPLASGLLTGKFTQDTV
FT                   FDDFRKDKPQFQGETFIHNLKKVDKLKAVAEEKQADTAHVALAWLLTRPAIDAIIPGAK
FT                   RPEQLQDNLKTLNIELTEDEVNFISDIFK"
     MDQTRTLGKT KLKVKRIGFG ANAVGGHNLF PNLNDETGKD LVRTALDGGV NFIDTAFIYG        60
     LGRSEELIGE VVQERGVRNE LIIATKGAHK EVDGSIELDN SREFLRSEVE KSLKRLKTDY       120
     IDLYYVHFPD GKTPLAEVAG TLKELKDEGK IKAIGASNLD YQQLQDFNAD GYLEVFQAEY       180
     SLIQRDAEKE LLPYCEKQGI SFIPYFPLAS GLLTGKFTQD TVFDDFRKDK PQFQGETFIH       240
     NLKKVDKLKA VAEEKQADTA HVALAWLLTR PAIDAIIPGA KRPEQLQDNL KTLNIELTED       300
     EVNFISDIFK                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page