(data stored in ACNUC7421 zone)

EMBL: AL009126.YCDB

AL009126.YCDB        Location/Qualifiers
FT   CDS             300830..302248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdB"
FT                   /locus_tag="BSU_02790"
FT                   /old_locus_tag="BSU02790"
FT                   /product="conserved protein of unknown function"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02790"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12073"
FT                   /db_xref="InterPro:IPR032599"
FT                   /db_xref="SubtiList:BG12758"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34621"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12073.1"
FT                   /translation="MKGAAFVKKEGLKQKALEIGRVPTHLKLEIEDYGGDDKRAHFCWA
FT                   DPQDENTGIIVELGPDGELESLSRDIEPESGERLSEEKLEDIMRQFVETHHPGALSAFV
FT                   REENDRAYGDKVRFSYVQMEAGLPLPMSGFMADVSLSGEIVYFRYYGEAGSIIKPKRVA
FT                   DVEEALAFIKKDVEFDLLFEVLHRSVYKNGDDQPHLVYEPEGRAITVPADLVQEEQAVD
FT                   DDDDYREPESFPLPLFEGIREKADPDSMIGIENGFVKEREADLGDGRIGIVWRNPDDPV
FT                   YQPADKSMDSWFKGRTHQVLKTIYNKETGKLEGVMSFMEKKGPLTVTLAECEKIALRFL
FT                   FALFPNADQYFRIRYDEKDEEENAVAGFTFEAHCHGVPLRFGQIRICVSRQTGYITVYM
FT                   GPDIDPNKLATIDPVPAISVEQAKSIFWQHFKVELGWEREYGDDEEHSYRLVYKPVYPH
FT                   FIDAHTGEPVFSIW"
     MKGAAFVKKE GLKQKALEIG RVPTHLKLEI EDYGGDDKRA HFCWADPQDE NTGIIVELGP        60
     DGELESLSRD IEPESGERLS EEKLEDIMRQ FVETHHPGAL SAFVREENDR AYGDKVRFSY       120
     VQMEAGLPLP MSGFMADVSL SGEIVYFRYY GEAGSIIKPK RVADVEEALA FIKKDVEFDL       180
     LFEVLHRSVY KNGDDQPHLV YEPEGRAITV PADLVQEEQA VDDDDDYREP ESFPLPLFEG       240
     IREKADPDSM IGIENGFVKE READLGDGRI GIVWRNPDDP VYQPADKSMD SWFKGRTHQV       300
     LKTIYNKETG KLEGVMSFME KKGPLTVTLA ECEKIALRFL FALFPNADQY FRIRYDEKDE       360
     EENAVAGFTF EAHCHGVPLR FGQIRICVSR QTGYITVYMG PDIDPNKLAT IDPVPAISVE       420
     QAKSIFWQHF KVELGWEREY GDDEEHSYRL VYKPVYPHFI DAHTGEPVFS IW               472
//

If you have problems or comments...

PBIL Back to PBIL home page