(data stored in ACNUC7421 zone)

EMBL: AL009126.YCDC

AL009126.YCDC        Location/Qualifiers
FT   CDS             302435..303796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdC"
FT                   /locus_tag="BSU_02800"
FT                   /old_locus_tag="BSU02800"
FT                   /product="conserved protein of unknown function"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02800"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12074"
FT                   /db_xref="InterPro:IPR032599"
FT                   /db_xref="SubtiList:BG12759"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34772"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12074.1"
FT                   /translation="MVNKQLKKKAQEIGNVPTHYELEIEDYDQKQKKYGQAYFIWKDPK
FT                   DPEKHITVELRNDGALLTFSTTVHSETDKKLPDAELKLTALQFAAANHPGTFMNFHFQG
FT                   KEERGQHIRFVYTKMELGLPIPNSGFLIDMTRSGQIVHFLYYGEGHKAEVPTEFVAKEK
FT                   VVSHYLNTMSFELMYDVIDGEQEPRLVYEPILPGYSYPADVDEIVPDQHIADERIENTA
FT                   PLPPLQNKEEVDIFALLGFTSDMQKVSERDFGEQIGSTWRRGAAPERKDLSIGSYFETR
FT                   NKNTIKMKTDKRTGKLKAALSFMDWRNNLQCSTEECQEIALQFLYALYPRAAEFFRVNP
FT                   VRIDERGRVRNHFSVWYKGVPLRFGAARIIVNPETGLIDAFMAPDIEPEQLEAINHRPD
FT                   VSAEEAKEAFLAAFDVKLEWQPDFTAGSDQHCKLVYKPVYPSYIDAHIRKKKRL"
     MVNKQLKKKA QEIGNVPTHY ELEIEDYDQK QKKYGQAYFI WKDPKDPEKH ITVELRNDGA        60
     LLTFSTTVHS ETDKKLPDAE LKLTALQFAA ANHPGTFMNF HFQGKEERGQ HIRFVYTKME       120
     LGLPIPNSGF LIDMTRSGQI VHFLYYGEGH KAEVPTEFVA KEKVVSHYLN TMSFELMYDV       180
     IDGEQEPRLV YEPILPGYSY PADVDEIVPD QHIADERIEN TAPLPPLQNK EEVDIFALLG       240
     FTSDMQKVSE RDFGEQIGST WRRGAAPERK DLSIGSYFET RNKNTIKMKT DKRTGKLKAA       300
     LSFMDWRNNL QCSTEECQEI ALQFLYALYP RAAEFFRVNP VRIDERGRVR NHFSVWYKGV       360
     PLRFGAARII VNPETGLIDA FMAPDIEPEQ LEAINHRPDV SAEEAKEAFL AAFDVKLEWQ       420
     PDFTAGSDQH CKLVYKPVYP SYIDAHIRKK KRL                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page