(data stored in ACNUC7421 zone)

EMBL: AL009126.YCDF

AL009126.YCDF        Location/Qualifiers
FT   CDS             305658..306434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdF"
FT                   /locus_tag="BSU_02830"
FT                   /old_locus_tag="BSU02830"
FT                   /product="putative oxidoreductase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10220166, 11948145,
FT                   15805528; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02830"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12077"
FT                   /db_xref="GOA:P80869"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="SubtiList:BG12761"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80869"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12077.1"
FT                   /translation="MYKDLTGKTAIVTGSSKGIGKAIAERFGKEKMNVVVNYHSDPSGA
FT                   DETLEIIKQNGGKAVSVEADVSKEEGIQALLDTALEHFGTLDVMVNNSGFNGVEAMPHE
FT                   MSLEDWQRVIDVNVTGTFLGAKAALNHMMKNNIKGNVLNISSVHQQIPRPVNVQYSTSK
FT                   GGIKMMTETLALNYADKGIRVNAIAPGTIATESNVDTKKEESRQKQLKKIPMKAFGKPE
FT                   EVAAAAAWLVSEEASYVTGATLFVDGGMTLYPSQLE"
     MYKDLTGKTA IVTGSSKGIG KAIAERFGKE KMNVVVNYHS DPSGADETLE IIKQNGGKAV        60
     SVEADVSKEE GIQALLDTAL EHFGTLDVMV NNSGFNGVEA MPHEMSLEDW QRVIDVNVTG       120
     TFLGAKAALN HMMKNNIKGN VLNISSVHQQ IPRPVNVQYS TSKGGIKMMT ETLALNYADK       180
     GIRVNAIAPG TIATESNVDT KKEESRQKQL KKIPMKAFGK PEEVAAAAAW LVSEEASYVT       240
     GATLFVDGGM TLYPSQLE                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page