(data stored in ACNUC7421 zone)

EMBL: AL009126.YCDG

AL009126.YCDG        Location/Qualifiers
FT   CDS             306459..308144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdG"
FT                   /locus_tag="BSU_02840"
FT                   /old_locus_tag="BSU02840"
FT                   /product="putative oligo-carbohydrate hydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.2.1.10"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 11544224; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02840"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12078"
FT                   /db_xref="GOA:O34364"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="SubtiList:BG12762"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34364"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12078.1"
FT                   /translation="MKTDWWKDAVVYQIYPRSFQDSNGDGIGDLRGIISRLDYIKELGA
FT                   DVIWICPIYPSPNVDYGYDVTNHKAIMDSYGTMDDFHELLDQVHQRGLKLVMDFVLNHT
FT                   SVEHPWFKEAELDKNSKYRSYYYWRPGTKNGPPTDWLSNYGCPVWQYEEHTGEYYLHMN
FT                   AVKQADLNWENPEVRQAVYDMMKFWLDKGVDGLRIDQLHLISKKEYLPSYEDYINQQAE
FT                   PKPFQPNGERIHDYLKEITDEVFSHYDVMSVGEVGSVTPEEGLKYTGTDKHELNMIFHF
FT                   QHMELDQQPGKEHWDLKPLELSDLKSVLTKWQKKLEHQGWNTLFWCNHDQPRIVSRFGD
FT                   DGEYRKASAKMLAAVIYFMKGTPYIYQGEEIGMTNAPFTRIEDYKDIQTINMYHKRVFE
FT                   KGYDPNDVMRSILAKSRDHARTPMQWNSGKNAGFTDGTPWLKVNPNFTAINVEEAQGDP
FT                   DSVLNYYKKLISLRKQYADLMKGSFDLLLPDDPQLFVYMRENSKQQLLSVNNFSKEQAV
FT                   FQWPKNCGKAQASLLLSNYNNDDLDDEMVFRPYESRVYLLDKTN"
     MKTDWWKDAV VYQIYPRSFQ DSNGDGIGDL RGIISRLDYI KELGADVIWI CPIYPSPNVD        60
     YGYDVTNHKA IMDSYGTMDD FHELLDQVHQ RGLKLVMDFV LNHTSVEHPW FKEAELDKNS       120
     KYRSYYYWRP GTKNGPPTDW LSNYGCPVWQ YEEHTGEYYL HMNAVKQADL NWENPEVRQA       180
     VYDMMKFWLD KGVDGLRIDQ LHLISKKEYL PSYEDYINQQ AEPKPFQPNG ERIHDYLKEI       240
     TDEVFSHYDV MSVGEVGSVT PEEGLKYTGT DKHELNMIFH FQHMELDQQP GKEHWDLKPL       300
     ELSDLKSVLT KWQKKLEHQG WNTLFWCNHD QPRIVSRFGD DGEYRKASAK MLAAVIYFMK       360
     GTPYIYQGEE IGMTNAPFTR IEDYKDIQTI NMYHKRVFEK GYDPNDVMRS ILAKSRDHAR       420
     TPMQWNSGKN AGFTDGTPWL KVNPNFTAIN VEEAQGDPDS VLNYYKKLIS LRKQYADLMK       480
     GSFDLLLPDD PQLFVYMREN SKQQLLSVNN FSKEQAVFQW PKNCGKAQAS LLLSNYNNDD       540
     LDDEMVFRPY ESRVYLLDKT N                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page