(data stored in ACNUC7421 zone)

EMBL: AL009126.YCEB

AL009126.YCEB        Location/Qualifiers
FT   CDS             complement(310880..311875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceB"
FT                   /locus_tag="BSU_02880"
FT                   /old_locus_tag="BSU02880"
FT                   /product="putative luciferase-like monooxygenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 16428414; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02880"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12082"
FT                   /db_xref="GOA:O34504"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="SubtiList:BG12766"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34504"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12082.2"
FT                   /translation="MIHLSILDQAPVSKGESPVTTLQHSVELAQLSEQWGYKRYWFAEH
FT                   HSTKGLASTAPEIMIARIAAQTNTIRVGSGGVLLPQYSPFKVAETFRQLEALYPNRIDL
FT                   GVGRSPGGTTKTRLALTDGVKKSLTEFNRQLQDVSYFLTDSLPPDHPYAGIKAAPLIGT
FT                   APELWVLGLGENSARRAAHQGIGYVFGHFINPERGENAFRIYRESFRPSAHFSNPSALF
FT                   TIFVICAKTDEEAEELALSQDLWLLRVGKGLDSRVPSIEEAKAHPYTASDKKLIEENRK
FT                   RMVIGSPTTVKQQLLDLTGCYETNEIMVLCNVFDFEAKKESYERLAELFL"
     MIHLSILDQA PVSKGESPVT TLQHSVELAQ LSEQWGYKRY WFAEHHSTKG LASTAPEIMI        60
     ARIAAQTNTI RVGSGGVLLP QYSPFKVAET FRQLEALYPN RIDLGVGRSP GGTTKTRLAL       120
     TDGVKKSLTE FNRQLQDVSY FLTDSLPPDH PYAGIKAAPL IGTAPELWVL GLGENSARRA       180
     AHQGIGYVFG HFINPERGEN AFRIYRESFR PSAHFSNPSA LFTIFVICAK TDEEAEELAL       240
     SQDLWLLRVG KGLDSRVPSI EEAKAHPYTA SDKKLIEENR KRMVIGSPTT VKQQLLDLTG       300
     CYETNEIMVL CNVFDFEAKK ESYERLAELF L                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page