(data stored in SCRATCH zone)

EMBL: AL009126.YCEC

AL009126.YCEC        Location/Qualifiers
FT   CDS             312159..312758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceC"
FT                   /locus_tag="BSU_02890"
FT                   /old_locus_tag="BSU02890"
FT                   /product="putative stress adaptation protein (tellurite
FT                   resistance)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 24366250; Product type
FT                   f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02890"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12083"
FT                   /db_xref="GOA:P81100"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="SubtiList:BG12767"
FT                   /db_xref="UniProtKB/Swiss-Prot:P81100"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12083.1"
FT                   /translation="MAISLEKGQRIDLTKGKAGLSKLMVGLGWDPVSSGGGFFSKLLGG
FT                   GGPNIDCDASVLMLENGKFTDKKNLIYFGNLKSRCGGVQHTGDNLTGDGAGDDEQIMID
FT                   LDKVPGNIDKLVFVVNIYDCVRRKQDFGMIQNAFIRVVDQSNHEEMLKYNLRDNYAGRT
FT                   SLITAEIYRSGSEWKFAAVGEGTNDTRLEDIISRYV"
     MAISLEKGQR IDLTKGKAGL SKLMVGLGWD PVSSGGGFFS KLLGGGGPNI DCDASVLMLE        60
     NGKFTDKKNL IYFGNLKSRC GGVQHTGDNL TGDGAGDDEQ IMIDLDKVPG NIDKLVFVVN       120
     IYDCVRRKQD FGMIQNAFIR VVDQSNHEEM LKYNLRDNYA GRTSLITAEI YRSGSEWKFA       180
     AVGEGTNDTR LEDIISRYV                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page