(data stored in ACNUC7421 zone)

EMBL: AL009126.YCED

AL009126.YCED        Location/Qualifiers
FT   CDS             312780..313361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceD"
FT                   /locus_tag="BSU_02900"
FT                   /old_locus_tag="BSU02900"
FT                   /product="putative stress adaptation protein (tellurite
FT                   resistance)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 22720735, 24366250;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02900"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12084"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="SubtiList:BG12768"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80875"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12084.1"
FT                   /translation="MTISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSS
FT                   VFLLDAAGKCASPNDFIFYNQLEGGNGSVVHSGDNLTGAGEGDDENVKVNLSAVPANID
FT                   KISFVITIHDAEARSQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGELYR
FT                   HNGEWKFSAIGSGYQGGLARIATDYGLQVG"
     MTISLAKGQK VDLTKTNPGL SKVVVGLGWD TNKYDGGHDF DLDSSVFLLD AAGKCASPND        60
     FIFYNQLEGG NGSVVHSGDN LTGAGEGDDE NVKVNLSAVP ANIDKISFVI TIHDAEARSQ       120
     NFGQVSNAFV RIVNEETNEE LIRYDLAEDF SIETAIIAGE LYRHNGEWKF SAIGSGYQGG       180
     LARIATDYGL QVG                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page