(data stored in SCRATCH zone)

EMBL: AL009126.YCEE

AL009126.YCEE        Location/Qualifiers
FT   CDS             313396..313974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceE"
FT                   /locus_tag="BSU_02910"
FT                   /old_locus_tag="BSU02910"
FT                   /product="putative stress adaptation protein (tellurite
FT                   resistance)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 22720735, 24366250,
FT                   25355936; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02910"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12085"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="SubtiList:BG12769"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34384"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12085.1"
FT                   /translation="MAIQLSKGQRIDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDAS
FT                   AFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDNRTGEGDGDDEQIIVDFSKIPAHIE
FT                   KIGITVTIHDAEARSQNFGQVSNAFVRVVDEETQNELLRFDLGEDFSIETAVVVCELYR
FT                   HGGEWKFNAIGSGFSGGLAALCRNYGLQV"
     MAIQLSKGQR IDLTKTNPGL TKAVIGLGWD TNKYSGGHDF DLDASAFLVD AHDNCVNDLD        60
     FVFYNNLEHP SGGVIHTGDN RTGEGDGDDE QIIVDFSKIP AHIEKIGITV TIHDAEARSQ       120
     NFGQVSNAFV RVVDEETQNE LLRFDLGEDF SIETAVVVCE LYRHGGEWKF NAIGSGFSGG       180
     LAALCRNYGL QV                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page