(data stored in SCRATCH zone)

EMBL: AL009126.YCEH

AL009126.YCEH        Location/Qualifiers
FT   CDS             316512..317603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceH"
FT                   /locus_tag="BSU_02940"
FT                   /old_locus_tag="BSU02940"
FT                   /product="putative reactive oxygen species resistance
FT                   protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 22720735, 24366250;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02940"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12088"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="SubtiList:BG12772"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34833"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12088.1"
FT                   /translation="MTTENQNPLVLDKNEEISQQKADDIRLQLRQEPEVKRLAQQIDVK
FT                   NQMELLEYGKEPAVEISKFSDRILGMMKTTSVTDSGTMLTQLGKIMDRFDKNDFDEPKG
FT                   LMAKIFKRGGSMIEKIFKKYQTLGGEIEKIHVEISKYKDEMTKTNYTLDEMYENNIKYY
FT                   MELEKYVVAGQMKLEEMQSILPSYEEKAASGNQLAQMQLDTLRNGIQALEERVYDLDMA
FT                   RMVALQTAPQIRLLQRGNAKLIGKINSAFIITIPIFKNGIIQAVTVKRQKLVADSMSEL
FT                   DRRTNEMLKRNAENISSQSVEIARMAGRPSIDIETIESSWNTIVSGMQETKQIEEENKR
FT                   LREDGARRIAQLQDNIKKAALQQ"
     MTTENQNPLV LDKNEEISQQ KADDIRLQLR QEPEVKRLAQ QIDVKNQMEL LEYGKEPAVE        60
     ISKFSDRILG MMKTTSVTDS GTMLTQLGKI MDRFDKNDFD EPKGLMAKIF KRGGSMIEKI       120
     FKKYQTLGGE IEKIHVEISK YKDEMTKTNY TLDEMYENNI KYYMELEKYV VAGQMKLEEM       180
     QSILPSYEEK AASGNQLAQM QLDTLRNGIQ ALEERVYDLD MARMVALQTA PQIRLLQRGN       240
     AKLIGKINSA FIITIPIFKN GIIQAVTVKR QKLVADSMSE LDRRTNEMLK RNAENISSQS       300
     VEIARMAGRP SIDIETIESS WNTIVSGMQE TKQIEEENKR LREDGARRIA QLQDNIKKAA       360
     LQQ                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page