(data stored in SCRATCH zone)

EMBL: AL009126.YCGB

AL009126.YCGB        Location/Qualifiers
FT   CDS             326888..327469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgB"
FT                   /locus_tag="BSU_03030"
FT                   /old_locus_tag="BSU03030"
FT                   /product="putative integral inner membrane protein of
FT                   unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 15849754, 16850406, 22720735; Product
FT                   type m: membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12097"
FT                   /db_xref="SubtiList:BG12000"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55909"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12097.2"
FT                   /translation="MNNLRNRLSGVNGKNKRVKEKEQKIWSEIGMIAGAFALLDVIIRG
FT                   IMFEFPFKEWAASLVFLFIIILYYCIRAAASGMLMPRIDTKEELQKRVKQQRIESIAVA
FT                   FAVVVLTMYDRGIPHTFFAWLKMILLFIVCGGVLFLLRYVIVKLAYRRAVKEEIKKKSS
FT                   FLFGKRGKRSQFRAAFFIGTLICIHSAKLF"
     MNNLRNRLSG VNGKNKRVKE KEQKIWSEIG MIAGAFALLD VIIRGIMFEF PFKEWAASLV        60
     FLFIIILYYC IRAAASGMLM PRIDTKEELQ KRVKQQRIES IAVAFAVVVL TMYDRGIPHT       120
     FFAWLKMILL FIVCGGVLFL LRYVIVKLAY RRAVKEEIKK KSSFLFGKRG KRSQFRAAFF       180
     IGTLICIHSA KLF                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page