(data stored in SCRATCH zone)

EMBL: AL009126.YCGG

AL009126.YCGG        Location/Qualifiers
FT   CDS             335329..336090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgG"
FT                   /locus_tag="BSU_03100"
FT                   /old_locus_tag="BSU03100"
FT                   /product="conserved protein of unknown function (similar to
FT                   phage protein)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03100"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12104"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="SubtiList:BG12005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94382"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12104.2"
FT                   /translation="MVNGIYTKSFLERIQEELPEWQRIAFELLAETLGDDADTFPCIPG
FT                   RQAFLTDQLRIAFAGDPRENRTAEELAPLLAEYGKISRDTGKYASLVVLFDTPEDLAEH
FT                   YSIEAYEELFWRFLNRLSHQDEKEWPEDIPADPEHYKWEFCFDGEPYFILCATPGHEAR
FT                   RSRSFPFFMVTFQPRWVFDDLNGSTAFGRNMSRLIRSRLEAYDQAPIHPQLGWYGGKDN
FT                   REWKQYFLRDDEKQVSKCPFSYLKNMFNKMK"
     MVNGIYTKSF LERIQEELPE WQRIAFELLA ETLGDDADTF PCIPGRQAFL TDQLRIAFAG        60
     DPRENRTAEE LAPLLAEYGK ISRDTGKYAS LVVLFDTPED LAEHYSIEAY EELFWRFLNR       120
     LSHQDEKEWP EDIPADPEHY KWEFCFDGEP YFILCATPGH EARRSRSFPF FMVTFQPRWV       180
     FDDLNGSTAF GRNMSRLIRS RLEAYDQAPI HPQLGWYGGK DNREWKQYFL RDDEKQVSKC       240
     PFSYLKNMFN KMK                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page