(data stored in SCRATCH zone)

EMBL: AL009126.YCGH

AL009126.YCGH        Location/Qualifiers
FT   CDS             complement(336092..337432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgH"
FT                   /locus_tag="BSU_03110"
FT                   /old_locus_tag="BSU03110"
FT                   /product="putative amino acid transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12105"
FT                   /db_xref="GOA:P94383"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="SubtiList:BG12006"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94383"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12105.2"
FT                   /translation="MSQTKKDQPKGNLAWWQLSLIGVGCTIGTGFFLGSSIAIVKSGFS
FT                   VLLSFLIAGIGTYFVFEQLAKLSAKQPEKGSFCAYARKAFGKWAGFSNGWVYWTSEMLI
FT                   TGSQLTAISLFTKHWFPQVPLWVFASIYAVLGLLIIFTGLSVFEKTENVLAVIKTAAIF
FT                   MFIVIAILALCGILSGGNHGIHVPNKTSEFFPYGAMGLWTGLIYAFYAFGGIEVMGLMA
FT                   VHLKKPEEASKSGKLMLATLAIIYIISIGLALLLVPLHTFTEQDSPFITSLKGYNLEII
FT                   LDIFNGIFIIAGFSTLVASLFAVTTLLCTMADDGDAPKCFTLKEGKKICWPALGLTFAG
FT                   LVLSIILSLVLPKNIYEHMTTAAGLMLLYTWLFILFSSKKLTDPEGMGKTQIYLAMVLI
FT                   AAAVSGTLFEKSSRPGFFVSIGFLVIIAIVTMIYQKKQGHKDRPASP"
     MSQTKKDQPK GNLAWWQLSL IGVGCTIGTG FFLGSSIAIV KSGFSVLLSF LIAGIGTYFV        60
     FEQLAKLSAK QPEKGSFCAY ARKAFGKWAG FSNGWVYWTS EMLITGSQLT AISLFTKHWF       120
     PQVPLWVFAS IYAVLGLLII FTGLSVFEKT ENVLAVIKTA AIFMFIVIAI LALCGILSGG       180
     NHGIHVPNKT SEFFPYGAMG LWTGLIYAFY AFGGIEVMGL MAVHLKKPEE ASKSGKLMLA       240
     TLAIIYIISI GLALLLVPLH TFTEQDSPFI TSLKGYNLEI ILDIFNGIFI IAGFSTLVAS       300
     LFAVTTLLCT MADDGDAPKC FTLKEGKKIC WPALGLTFAG LVLSIILSLV LPKNIYEHMT       360
     TAAGLMLLYT WLFILFSSKK LTDPEGMGKT QIYLAMVLIA AAVSGTLFEK SSRPGFFVSI       420
     GFLVIIAIVT MIYQKKQGHK DRPASP                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page