(data stored in SCRATCH zone)

EMBL: AL009126.YCGI

AL009126.YCGI        Location/Qualifiers
FT   CDS             337562..338158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgI"
FT                   /locus_tag="BSU_03120"
FT                   /old_locus_tag="BSU03120"
FT                   /product="xenotiotic metabolite methyltransferase"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 16433904, 28898812; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12106"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="SubtiList:BG12007"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31473"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12106.3"
FT                   /translation="MTQQYIVEPKKGLGLKLKKGQILKVVDVEGQQVADFVAYHAKDFY
FT                   EHLDQGATIDANHSIHVKVNDHLYSNLYKPMLTLIEDTVGKHDLLLPACRPDMNRLLYG
FT                   KQKDEFQDTCYDNMNRALEQFGVPKPHMHYPFAIFMNTVLDEKGNLSVETPLSNAGDYV
FT                   RLRAEMDLIVAFSSCPIEKGKCNGDSVTSIRVEVS"
     MTQQYIVEPK KGLGLKLKKG QILKVVDVEG QQVADFVAYH AKDFYEHLDQ GATIDANHSI        60
     HVKVNDHLYS NLYKPMLTLI EDTVGKHDLL LPACRPDMNR LLYGKQKDEF QDTCYDNMNR       120
     ALEQFGVPKP HMHYPFAIFM NTVLDEKGNL SVETPLSNAG DYVRLRAEMD LIVAFSSCPI       180
     EKGKCNGDSV TSIRVEVS                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page