(data stored in SCRATCH zone)

EMBL: AL009126.YCGL

AL009126.YCGL        Location/Qualifiers
FT   CDS             343578..344360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgL"
FT                   /locus_tag="BSU_03190"
FT                   /old_locus_tag="BSU03190"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12113"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="SubtiList:BG12010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94389"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12113.1"
FT                   /translation="MKQRIIDELKRIEQSYGVKIVYAVESGSRAWGFPSQDSDYDVRFI
FT                   YVPKKEWYFSIEQERDVIEEPIHDLLDISGWELRKTLRLFKKSNPPLLEWLSSDIVYYE
FT                   AFTTAEQLRKLRTEAFKPEASVYHYINMARRNVKDYLQGQEVKIKKYFYVLRPILACQW
FT                   IEKHGTIPPMDFTVLMNELVAEPELKAEMETLLERKRRGEELDLEARIDVIHQFIETEI
FT                   ERIMEAAKELKAEKKDMTSELNRLLLNTVEEVWKDGGS"
     MKQRIIDELK RIEQSYGVKI VYAVESGSRA WGFPSQDSDY DVRFIYVPKK EWYFSIEQER        60
     DVIEEPIHDL LDISGWELRK TLRLFKKSNP PLLEWLSSDI VYYEAFTTAE QLRKLRTEAF       120
     KPEASVYHYI NMARRNVKDY LQGQEVKIKK YFYVLRPILA CQWIEKHGTI PPMDFTVLMN       180
     ELVAEPELKA EMETLLERKR RGEELDLEAR IDVIHQFIET EIERIMEAAK ELKAEKKDMT       240
     SELNRLLLNT VEEVWKDGGS                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page