(data stored in SCRATCH zone)

EMBL: AL009126.YCGQ

AL009126.YCGQ        Location/Qualifiers
FT   CDS             complement(349996..350853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgQ"
FT                   /locus_tag="BSU_03240"
FT                   /old_locus_tag="BSU03240"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03240"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12118"
FT                   /db_xref="GOA:P94394"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="SubtiList:BG12015"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94394"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12118.1"
FT                   /translation="MFRLLVLMGFTFFFYHLHASGNLTKYINMKYAYLSFIAIFLLAIL
FT                   TAVQAYLFIKSPEKSGHHHDHDCGCGHDHEHDHEQNKPFYQRYLIYVVFLFPLVSGIFF
FT                   PIATLDSSIVKTKGFSFKAMESGDHYSQTQYLRPDASLYYAQDSYDKQMKQLFNKYSSK
FT                   KEISLTDDDFLKGMETIYNYPGEFLGRTIEFHGFAYKGNAINKNQLFVLRFGIIHCIAD
FT                   SGVYGMLVEFPKDMDIKDDEWIHIKGTLASEYYQPFKSTLPVVKVTDWNTIKKPDDPYV
FT                   YRGF"
     MFRLLVLMGF TFFFYHLHAS GNLTKYINMK YAYLSFIAIF LLAILTAVQA YLFIKSPEKS        60
     GHHHDHDCGC GHDHEHDHEQ NKPFYQRYLI YVVFLFPLVS GIFFPIATLD SSIVKTKGFS       120
     FKAMESGDHY SQTQYLRPDA SLYYAQDSYD KQMKQLFNKY SSKKEISLTD DDFLKGMETI       180
     YNYPGEFLGR TIEFHGFAYK GNAINKNQLF VLRFGIIHCI ADSGVYGMLV EFPKDMDIKD       240
     DEWIHIKGTL ASEYYQPFKS TLPVVKVTDW NTIKKPDDPY VYRGF                       285
//

If you have problems or comments...

PBIL Back to PBIL home page