(data stored in ACNUC7421 zone)

EMBL: AL009126.YCGS

AL009126.YCGS        Location/Qualifiers
FT   CDS             complement(351842..352696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgS"
FT                   /locus_tag="BSU_03260"
FT                   /old_locus_tag="BSU03260"
FT                   /product="putative aromatic hydrocarbon hydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.7.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03260"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12120"
FT                   /db_xref="GOA:P94396"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG12017"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94396"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12120.1"
FT                   /translation="MKRRVETITFDGGTLEYSVTGKGTPILVMHGGHSNCYEEFGYTAL
FT                   IEQGYSIITPSRPGYGRTSKEIGKSLANACRFYVKLLDHLQIESVHVIAISAGGPSGIC
FT                   FASHYPERVNTLTLQSAVTKEWLTPKDTEYKLGEILFRPPVEKWIWKLISSLNNAFPRL
FT                   MFRAMSPQFSTLPFQRIKSLMNEKDIEAFRKMNSRQRSGEGFLIDLSQTAAVSLKDLQA
FT                   IICPVLIMQSVYDGLVDLSHAHHAKEHIRGAVLCLLHSWGHLIWLGKEAAETGSILLGF
FT                   LES"
     MKRRVETITF DGGTLEYSVT GKGTPILVMH GGHSNCYEEF GYTALIEQGY SIITPSRPGY        60
     GRTSKEIGKS LANACRFYVK LLDHLQIESV HVIAISAGGP SGICFASHYP ERVNTLTLQS       120
     AVTKEWLTPK DTEYKLGEIL FRPPVEKWIW KLISSLNNAF PRLMFRAMSP QFSTLPFQRI       180
     KSLMNEKDIE AFRKMNSRQR SGEGFLIDLS QTAAVSLKDL QAIICPVLIM QSVYDGLVDL       240
     SHAHHAKEHI RGAVLCLLHS WGHLIWLGKE AAETGSILLG FLES                        284
//

If you have problems or comments...

PBIL Back to PBIL home page