(data stored in ACNUC7421 zone)

EMBL: AL009126.YCKB

AL009126.YCKB        Location/Qualifiers
FT   CDS             complement(367995..368858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckB"
FT                   /locus_tag="BSU_03380"
FT                   /old_locus_tag="BSU03380"
FT                   /product="amino acid ABC transporter (binding lipoprotein
FT                   subunit)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 23038252; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12132"
FT                   /db_xref="GOA:P42400"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="PDB:2IEE"
FT                   /db_xref="SubtiList:BG11178"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42400"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:23038252"
FT                   /protein_id="CAB12132.1"
FT                   /translation="MKSFMHSKAVIFSFTMAFFLILAACSGKNEADSKDTGWEQIKDKG
FT                   KIVVATSGTLYPTSYHDTDSGSDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVN
FT                   SGQVDAAANDIDVTKDREEKFAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGAA
FT                   TTVYMEVARKYGAKEVIYDNATNEQYLKDVANGRTDVILNDYYLQTLALAAFPDLNITI
FT                   HPDIKYMPNKQALVMKKSNAALQKKMNEALKEMSKDGSLTKLSKQFFNKADVSKKIDAD
FT                   VQDVDL"
     MKSFMHSKAV IFSFTMAFFL ILAACSGKNE ADSKDTGWEQ IKDKGKIVVA TSGTLYPTSY        60
     HDTDSGSDKL TGYEVEVVRE AAKRLGLKVE FKEMGIDGML TAVNSGQVDA AANDIDVTKD       120
     REEKFAFSTP YKYSYGTAIV RKDDLSGIKT LKDLKGKKAA GAATTVYMEV ARKYGAKEVI       180
     YDNATNEQYL KDVANGRTDV ILNDYYLQTL ALAAFPDLNI TIHPDIKYMP NKQALVMKKS       240
     NAALQKKMNE ALKEMSKDGS LTKLSKQFFN KADVSKKIDA DVQDVDL                     287
//

If you have problems or comments...

PBIL Back to PBIL home page