(data stored in ACNUC7421 zone)

EMBL: AL009126.YCKC

AL009126.YCKC        Location/Qualifiers
FT   CDS             369236..369691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckC"
FT                   /locus_tag="BSU_03390"
FT                   /old_locus_tag="BSU03390"
FT                   /product="conserved integral membrane protein of unknown
FT                   function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 15849754, 16850406; Product type m:
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03390"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12133"
FT                   /db_xref="GOA:P42401"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="SubtiList:BG11179"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42401"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12133.1"
FT                   /translation="MNIYKPAGFWIRLGAALLDYIIVSVPLLLIYWLITGKDPNDSMFI
FT                   SLVVLLYSILLPMFWRGYLIGKRICGIRIVKKDGSQVSLLTMFLRVIVAGLVYCITFGL
FT                   GLIASLILIAVREDKRTLHDLIAGTYVTYATPGEEELNADEEIRKSE"
     MNIYKPAGFW IRLGAALLDY IIVSVPLLLI YWLITGKDPN DSMFISLVVL LYSILLPMFW        60
     RGYLIGKRIC GIRIVKKDGS QVSLLTMFLR VIVAGLVYCI TFGLGLIASL ILIAVREDKR       120
     TLHDLIAGTY VTYATPGEEE LNADEEIRKS E                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page