(data stored in SCRATCH zone)

EMBL: AL009126.YCLD

AL009126.YCLD        Location/Qualifiers
FT   CDS             414819..415283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclD"
FT                   /locus_tag="BSU_03652"
FT                   /old_locus_tag="BSU03652"
FT                   /product="putative FMN-binding enzyme subunit"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15979273, 18388975;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03652"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12159"
FT                   /db_xref="GOA:C0SPB5"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="SubtiList:BG12025"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SPB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12159.2"
FT                   /translation="MIRVNCMSDRLFELLDGSCLNEKQHEAFVLQTVSEDGWPHAAMIS
FT                   AGEIIALSRTDIRIALWKNTMTSANILRTGKAQFTAWWKGAAYYVKLECAPLPPLKDAE
FT                   YERDRFSCRIVSVKEDVAKYADLTSGVRIQLHSPEEVLSRWKKTLEDLKR"
     MIRVNCMSDR LFELLDGSCL NEKQHEAFVL QTVSEDGWPH AAMISAGEII ALSRTDIRIA        60
     LWKNTMTSAN ILRTGKAQFT AWWKGAAYYV KLECAPLPPL KDAEYERDRF SCRIVSVKED       120
     VAKYADLTSG VRIQLHSPEE VLSRWKKTLE DLKR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page