(data stored in SCRATCH zone)

EMBL: AL009126.YCLE

AL009126.YCLE        Location/Qualifiers
FT   CDS             415350..416195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclE"
FT                   /locus_tag="BSU_03660"
FT                   /old_locus_tag="BSU03660"
FT                   /product="putative hydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03660"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12160"
FT                   /db_xref="GOA:P94407"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG12026"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94407"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12160.2"
FT                   /translation="MERAGICHSDGFDLAYRIEGEGAPILVIGSAVYYPRLFSSDIKQK
FT                   YQWVFVDHRGFAKPKRELRAEDSRLDAVLADIERMRTFLQLEDVTILGHSGHAFMALEY
FT                   ARTYPKQVRKVALFNTAPDNSEERQRKSESFFMETASLERKKRFEKDIENLPQDIDKDP
FT                   ERRFVHMCIRAEAKSFYQERPHAAALWDGVFTNMPIIDELWGNTFARIDLLQRLADVRM
FT                   PVYIGLGRYDYLVAPVSLWDAVDGLYPHVDKVIFEKSGHQPMLEEPEAFDQSFRKWLDQ
FT                   "
     MERAGICHSD GFDLAYRIEG EGAPILVIGS AVYYPRLFSS DIKQKYQWVF VDHRGFAKPK        60
     RELRAEDSRL DAVLADIERM RTFLQLEDVT ILGHSGHAFM ALEYARTYPK QVRKVALFNT       120
     APDNSEERQR KSESFFMETA SLERKKRFEK DIENLPQDID KDPERRFVHM CIRAEAKSFY       180
     QERPHAAALW DGVFTNMPII DELWGNTFAR IDLLQRLADV RMPVYIGLGR YDYLVAPVSL       240
     WDAVDGLYPH VDKVIFEKSG HQPMLEEPEA FDQSFRKWLD Q                           281
//

If you have problems or comments...

PBIL Back to PBIL home page