(data stored in ACNUC7421 zone)

EMBL: AL009126.YCLG

AL009126.YCLG        Location/Qualifiers
FT   CDS             417993..419747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclG"
FT                   /locus_tag="BSU_03680"
FT                   /old_locus_tag="BSU03680"
FT                   /product="putative uronase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03680"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12176"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="SubtiList:BG12028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94409"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12176.1"
FT                   /translation="MAEFILNAADFGVPRDGKTDSTERINQCLSTAVSKGYHTVWFPKG
FT                   TYLIDATLGGDLNQRFRNAGIIVPGNLEIMMDPECIMKVIPNSSWGYSAFYVGKQENIT
FT                   ISGGQIIGERDEHTYASAGIRSTHEWGFGICIEGCSNVVIDDVKISDFTGDGIIVSPRG
FT                   LKTNQDYRTSEQIIIRRCEVRRSRRNNISITGCDMVTVEECLIEDAGTGNGTAPKFGID
FT                   IEGYGEGDVDYEEPINVSIRNNHFVGNVSSSVTNFNGYGILIEGNHSDNTISYGYGTQT
FT                   VIKGNILRRPEDAAAAPRVGITGLGVSQGKETSDAVIAGNLITGFSTGIDVRGKSVLVT
FT                   NNKISNFENTGILVYQSSDVKVDGNQIQNGLSETRRSIGLRAVLSDDIAFLNNCLIQVV
FT                   DGVNVSGGNMIIKDNLLRKFSRGIWIAQGNAVIEGNTLNPDAFEAVPESYSVSVTNNAG
FT                   AIIKNNTFKEFKNYPIYCSTSAKTSIIGNHLERSPLLVTIYISAGVHEIFDNTISVNRT
FT                   AGNPIVIYLNGSAGSIISGNTINNLSAGTATAIQTNTSTNSKIIGNRIFKGTINKHSSD
FT                   TIDGNMIV"
     MAEFILNAAD FGVPRDGKTD STERINQCLS TAVSKGYHTV WFPKGTYLID ATLGGDLNQR        60
     FRNAGIIVPG NLEIMMDPEC IMKVIPNSSW GYSAFYVGKQ ENITISGGQI IGERDEHTYA       120
     SAGIRSTHEW GFGICIEGCS NVVIDDVKIS DFTGDGIIVS PRGLKTNQDY RTSEQIIIRR       180
     CEVRRSRRNN ISITGCDMVT VEECLIEDAG TGNGTAPKFG IDIEGYGEGD VDYEEPINVS       240
     IRNNHFVGNV SSSVTNFNGY GILIEGNHSD NTISYGYGTQ TVIKGNILRR PEDAAAAPRV       300
     GITGLGVSQG KETSDAVIAG NLITGFSTGI DVRGKSVLVT NNKISNFENT GILVYQSSDV       360
     KVDGNQIQNG LSETRRSIGL RAVLSDDIAF LNNCLIQVVD GVNVSGGNMI IKDNLLRKFS       420
     RGIWIAQGNA VIEGNTLNPD AFEAVPESYS VSVTNNAGAI IKNNTFKEFK NYPIYCSTSA       480
     KTSIIGNHLE RSPLLVTIYI SAGVHEIFDN TISVNRTAGN PIVIYLNGSA GSIISGNTIN       540
     NLSAGTATAI QTNTSTNSKI IGNRIFKGTI NKHSSDTIDG NMIV                        584
//

If you have problems or comments...

PBIL Back to PBIL home page