(data stored in ACNUC7421 zone)

EMBL: AL009126.YCLK

AL009126.YCLK        Location/Qualifiers
FT   CDS             427247..428668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclK"
FT                   /locus_tag="BSU_03760"
FT                   /old_locus_tag="BSU03760"
FT                   /product="two-component sensor histidine kinase [YclJ]"
FT                   /function="16.12: Sense"
FT                   /function="16.3: Control"
FT                   /function="16.10: Respire"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 15375128, 20512483;
FT                   Product type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03760"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12184"
FT                   /db_xref="GOA:P94414"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG12032"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94414"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 15375128, 20512483"
FT                   /protein_id="CAB12184.1"
FT                   /translation="MMKIKYLYQLLLSHISILILAFVIIISLFSHFVKEFAYQNKVEEL
FT                   TSYAVQIANEFQSGQVDMRRLYPYQDILSTRKTQFIIFNEEQQPYFLPEGFHHPPREQL
FT                   KKSEWNKLKKGQTVTIRADGRFDDEVSLVAQPIFVQNEFKGAVLLISPISGVEQMVNQV
FT                   NLYMFYAVISTLVITILVSWLLSKFHVKRIQKLREATDKVASGDYDIHLENSYGDEIGV
FT                   LASDFNIMAKKLKQSRDEIERLEKRRRQFIADVSHELKTPLTTINGLVEGLNSHTIPED
FT                   KKDKCFSLISEETKRMLRLVKENLDYEKIRSQQITLNKLDVPLIEVFEIVKEHLQQQAE
FT                   EKQNKLMIQVEDHVIVHADYDRFIQILVNITKNSIQFTQNGDIWLRGMEGYKETIIEIE
FT                   DTGIGIPKEDIEHIWERFYKADISRTNTAYGEYGLGLSIVRQLVEMHQGTVEIKSEEGK
FT                   GTKFIIRLPLTAKQQ"
     MMKIKYLYQL LLSHISILIL AFVIIISLFS HFVKEFAYQN KVEELTSYAV QIANEFQSGQ        60
     VDMRRLYPYQ DILSTRKTQF IIFNEEQQPY FLPEGFHHPP REQLKKSEWN KLKKGQTVTI       120
     RADGRFDDEV SLVAQPIFVQ NEFKGAVLLI SPISGVEQMV NQVNLYMFYA VISTLVITIL       180
     VSWLLSKFHV KRIQKLREAT DKVASGDYDI HLENSYGDEI GVLASDFNIM AKKLKQSRDE       240
     IERLEKRRRQ FIADVSHELK TPLTTINGLV EGLNSHTIPE DKKDKCFSLI SEETKRMLRL       300
     VKENLDYEKI RSQQITLNKL DVPLIEVFEI VKEHLQQQAE EKQNKLMIQV EDHVIVHADY       360
     DRFIQILVNI TKNSIQFTQN GDIWLRGMEG YKETIIEIED TGIGIPKEDI EHIWERFYKA       420
     DISRTNTAYG EYGLGLSIVR QLVEMHQGTV EIKSEEGKGT KFIIRLPLTA KQQ              473
//

If you have problems or comments...

PBIL Back to PBIL home page