(data stored in ACNUC7421 zone)

EMBL: AL009126.YCNE

AL009126.YCNE        Location/Qualifiers
FT   CDS             complement(439282..439569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnE"
FT                   /locus_tag="BSU_03870"
FT                   /old_locus_tag="BSU03870"
FT                   /product="putative AI-2 degrading enzyme"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 17274596, 21454635;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03870"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12195"
FT                   /db_xref="GOA:P94425"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="SubtiList:BG12041"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94425"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12195.1"
FT                   /translation="MIVLQAYIKVKPEKREEFLSEAQSLVQHSRAEEGNAQYDLFEKVG
FT                   EENTFVMLEKWKDEAAMKFHNETAHFQGFVAKGKELLSAPLDVVRTELSE"
     MIVLQAYIKV KPEKREEFLS EAQSLVQHSR AEEGNAQYDL FEKVGEENTF VMLEKWKDEA        60
     AMKFHNETAH FQGFVAKGKE LLSAPLDVVR TELSE                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page