(data stored in ACNUC7421 zone)

EMBL: AL009126.YCNL

AL009126.YCNL        Location/Qualifiers
FT   CDS             449198..449551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnL"
FT                   /locus_tag="BSU_03970"
FT                   /old_locus_tag="BSU03970"
FT                   /product="putative reductase or disulfide isomerase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406,
FT                   18307109, 27010565; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03970"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12205"
FT                   /db_xref="GOA:P94434"
FT                   /db_xref="SubtiList:BG12048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94434"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12205.1"
FT                   /translation="MKETPCPNCGKPLTGDMVRSSNVPCQFRCGHCRERLYEYKVSAPI
FT                   MLVSLAAIVLLIYLLMLLRNAAGSVLPAVQHVPMAVFALVCAYPVFIVSERMIAKYVIQ
FT                   NGNIIYRGKRKGS"
     MKETPCPNCG KPLTGDMVRS SNVPCQFRCG HCRERLYEYK VSAPIMLVSL AAIVLLIYLL        60
     MLLRNAAGSV LPAVQHVPMA VFALVCAYPV FIVSERMIAK YVIQNGNIIY RGKRKGS          117
//

If you have problems or comments...

PBIL Back to PBIL home page