(data stored in ACNUC7421 zone)

EMBL: AL009126.YCSA

AL009126.YCSA        Location/Qualifiers
FT   CDS             452830..453894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsA"
FT                   /locus_tag="BSU_04000"
FT                   /old_locus_tag="BSU04000"
FT                   /product="putative tartrate dehydrogenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.93"
FT                   /EC_number="1.1.1.83"
FT                   /EC_number="4.1.1.73"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10568751, 12356321; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04000"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12208"
FT                   /db_xref="GOA:P42958"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="SubtiList:BG11222"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42958"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12208.3"
FT                   /translation="MTMKQFEIAAIPGDGVGKEVVAAAEKVLHTAAEVHGGLSFSFTAF
FT                   PWSCDYYLEHGKMMPEDGIHTLTQFEAVFLGAVGNPKLVPDHISLWGLLLKIRRELELS
FT                   INMRPAKQMAGITSPLLHPNDFDFVVIRENSEGEYSEVGGRIHRGDDEIAIQNAVFTRK
FT                   ATERVMRFAFELAKKRRSHVTSATKSNGIYHAMPFWDEVFQQTAADYSGIETSSQHIDA
FT                   LAAFFVTRPETFDVIVASNLFGDILTDISSSLMGSIGIAPSANINPSGKYPSMFEPVHG
FT                   SAPDIAGQGLANPIGQIWTAKLMLDHFGEEELGAKILDVMEQVTADGIKTRDIGGQSTT
FT                   AEVTDEICSRLRKL"
     MTMKQFEIAA IPGDGVGKEV VAAAEKVLHT AAEVHGGLSF SFTAFPWSCD YYLEHGKMMP        60
     EDGIHTLTQF EAVFLGAVGN PKLVPDHISL WGLLLKIRRE LELSINMRPA KQMAGITSPL       120
     LHPNDFDFVV IRENSEGEYS EVGGRIHRGD DEIAIQNAVF TRKATERVMR FAFELAKKRR       180
     SHVTSATKSN GIYHAMPFWD EVFQQTAADY SGIETSSQHI DALAAFFVTR PETFDVIVAS       240
     NLFGDILTDI SSSLMGSIGI APSANINPSG KYPSMFEPVH GSAPDIAGQG LANPIGQIWT       300
     AKLMLDHFGE EELGAKILDV MEQVTADGIK TRDIGGQSTT AEVTDEICSR LRKL             354
//

If you have problems or comments...

PBIL Back to PBIL home page