(data stored in ACNUC7421 zone)

EMBL: AL009126.YCSD

AL009126.YCSD        Location/Qualifiers
FT   CDS             455346..455738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsD"
FT                   /locus_tag="BSU_04030"
FT                   /old_locus_tag="BSU04030"
FT                   /product="putative hydroxyacyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.2.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12682299, 16291680,
FT                   22720735; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12211"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="SubtiList:BG11225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42961"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12211.2"
FT                   /translation="MNSLSLPHRYPFLFIDGVTDSEPGKHAAAYKLISENDWFITDTQT
FT                   EMPFSLVIEALAQTAAFTGITDENSLGLLSSVKKAEKLGEAVPGDRLDLTFEVTRNRRG
FT                   FVFGHAKASVGEQPVAEAEIGIYIEK"
     MNSLSLPHRY PFLFIDGVTD SEPGKHAAAY KLISENDWFI TDTQTEMPFS LVIEALAQTA        60
     AFTGITDENS LGLLSSVKKA EKLGEAVPGD RLDLTFEVTR NRRGFVFGHA KASVGEQPVA       120
     EAEIGIYIEK                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page