(data stored in ACNUC7421 zone)

EMBL: AL009126.YCSN

AL009126.YCSN        Location/Qualifiers
FT   CDS             466042..466944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsN"
FT                   /locus_tag="BSU_04150"
FT                   /old_locus_tag="BSU04150"
FT                   /product="putative oxidoreductase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 22720735; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04150"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12222"
FT                   /db_xref="GOA:P42972"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="SubtiList:BG11235"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42972"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12222.1"
FT                   /translation="MQRIQLAEDLQFSRVIHGLWRLNEWNYSDAELLSLIEWCIDHGIT
FT                   TFDHADIYGGYTCEKLFGNALALSPGLRENIELVTKCGIVLESPERPAHRSHHYNTSKS
FT                   HILASVEQSLMNLRTDYIDMLLIHRPDPLMDPEGVAEAFQALKCSGKVRYFGVSNFKDH
FT                   QYRMLESYLPEKLVTNQIELSAYELENMLDGTLNLCQEKRIPPMAWSPLAGGKVFTENT
FT                   DKDRRVRTALESVQGEIGAASLDEVMYAWLYTHPAGIMPIVGSGKRERISAAINALSYK
FT                   LDQDQWFRIFTAVQGYDIP"
     MQRIQLAEDL QFSRVIHGLW RLNEWNYSDA ELLSLIEWCI DHGITTFDHA DIYGGYTCEK        60
     LFGNALALSP GLRENIELVT KCGIVLESPE RPAHRSHHYN TSKSHILASV EQSLMNLRTD       120
     YIDMLLIHRP DPLMDPEGVA EAFQALKCSG KVRYFGVSNF KDHQYRMLES YLPEKLVTNQ       180
     IELSAYELEN MLDGTLNLCQ EKRIPPMAWS PLAGGKVFTE NTDKDRRVRT ALESVQGEIG       240
     AASLDEVMYA WLYTHPAGIM PIVGSGKRER ISAAINALSY KLDQDQWFRI FTAVQGYDIP       300
//

If you have problems or comments...

PBIL Back to PBIL home page