(data stored in SCRATCH zone)

EMBL: AL009126.YCXB

AL009126.YCXB        Location/Qualifiers
FT   CDS             complement(404458..405015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxB"
FT                   /locus_tag="BSU_03540"
FT                   /old_locus_tag="BSU03540"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function; PubMedId : 21965396"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03540"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12148"
FT                   /db_xref="GOA:Q08793"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="SubtiList:BG10173"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08793"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12148.1"
FT                   /translation="MIQYASESINLPGEITFKDVREIFFYQIAKISCFYFLLFCAIFAA
FT                   VNFINGWPRIVYGSDALNLFMNSMLIIVMSVLFTLLLLLLLYVKFSRAYKKNERMKSKR
FT                   TYTLNQEGIRICSKKYDLIFNWDEITAVFEYKNIFRVNTSSGQYIAIPKHFFHSEEEMN
FT                   RFKEIILKNTETKKLKFKKDQH"
     MIQYASESIN LPGEITFKDV REIFFYQIAK ISCFYFLLFC AIFAAVNFIN GWPRIVYGSD        60
     ALNLFMNSML IIVMSVLFTL LLLLLLYVKF SRAYKKNERM KSKRTYTLNQ EGIRICSKKY       120
     DLIFNWDEIT AVFEYKNIFR VNTSSGQYIA IPKHFFHSEE EMNRFKEIIL KNTETKKLKF       180
     KKDQH                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page