(data stored in ACNUC7421 zone)

EMBL: AL009126.YCZC

AL009126.YCZC        Location/Qualifiers
FT   CDS             complement(292881..293264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczC"
FT                   /locus_tag="BSU_02710"
FT                   /old_locus_tag="BSU02710"
FT                   /product="putative integral membrane protein of unknown
FT                   function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 15849754, 16850406; Product type m:
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02710"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12065"
FT                   /db_xref="GOA:O31469"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="SubtiList:BG12778"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31469"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12065.1"
FT                   /translation="MELAGFMLRACALLLDVIIAAAVILAAGFTFGDGSAGVIIVAILM
FT                   LIVYPLLMPLTNWKGTLGKKIIGLQIVRDETYKKISFPQAIVRYLIAWVHVFSRLIYLT
FT                   AAFTKKKQTVHDMAAKTIVLKAE"
     MELAGFMLRA CALLLDVIIA AAVILAAGFT FGDGSAGVII VAILMLIVYP LLMPLTNWKG        60
     TLGKKIIGLQ IVRDETYKKI SFPQAIVRYL IAWVHVFSRL IYLTAAFTKK KQTVHDMAAK       120
     TIVLKAE                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page