(data stored in ACNUC7421 zone)

EMBL: AL009126.YCZE

AL009126.YCZE        Location/Qualifiers
FT   CDS             complement(408240..408887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczE"
FT                   /locus_tag="BSU_03580"
FT                   /old_locus_tag="BSU03580"
FT                   /product="integral inner membrane protein regulating
FT                   antibiotic production"
FT                   /function="15.11: Biosynthesis of natural products"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15849754, 16850406, 17827323,
FT                   14762003, 16707694, 17827323, 25288929; Product type m:
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03580"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12152"
FT                   /db_xref="GOA:O34927"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="SubtiList:BG12779"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34927"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12152.2"
FT                   /translation="MKQELVLRWTFYFAGLIILAFGVSLTIEGKALGISPWDAFHYSLF
FT                   QHFGLTVGQWSIIIGALIVGFTSLFTRAWPKIGALLNMVLIGVFIDFFNFILPALSTYT
FT                   GSIIVFSLGVVLIGYGVGVYVSAGLGAGPRDSLMMLITEKTGWNVQWVRNGMELTILFA
FT                   AWGMGGPIGFGTILTAILTGLILRFSLPQSIQLLNYAVARRTAAVKASPPVH"
     MKQELVLRWT FYFAGLIILA FGVSLTIEGK ALGISPWDAF HYSLFQHFGL TVGQWSIIIG        60
     ALIVGFTSLF TRAWPKIGAL LNMVLIGVFI DFFNFILPAL STYTGSIIVF SLGVVLIGYG       120
     VGVYVSAGLG AGPRDSLMML ITEKTGWNVQ WVRNGMELTI LFAAWGMGGP IGFGTILTAI       180
     LTGLILRFSL PQSIQLLNYA VARRTAAVKA SPPVH                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page