(data stored in SCRATCH zone)

EMBL: AL009126.YCZF

AL009126.YCZF        Location/Qualifiers
FT   CDS             complement(419763..419984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczF"
FT                   /locus_tag="BSU_03690"
FT                   /old_locus_tag="BSU03690"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03690"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12177"
FT                   /db_xref="GOA:O31479"
FT                   /db_xref="SubtiList:BG12780"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31479"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12177.1"
FT                   /translation="MKILGVTGFILICLLAISVLMDMLQGFSLTKAVYNNMSSFKMTTF
FT                   AEWVVLLFFVLVLVREMYVIYKSKKKNP"
     MKILGVTGFI LICLLAISVL MDMLQGFSLT KAVYNNMSSF KMTTFAEWVV LLFFVLVLVR        60
     EMYVIYKSKK KNP                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page