(data stored in SCRATCH zone)

EMBL: AL009126.YCZH

AL009126.YCZH        Location/Qualifiers
FT   CDS             complement(454652..455260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczH"
FT                   /locus_tag="BSU_04020"
FT                   /old_locus_tag="BSU04020"
FT                   /product="putative hydrolase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04020"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12210"
FT                   /db_xref="GOA:O31482"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG12782"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31482"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12210.2"
FT                   /translation="MFPKPLVILAHEIYGVNSHMKKMGRLIKMAGYDVLTPNLLGEDEV
FT                   YTLKEEKTAYEQFTKHERLKTGETIIQNVIRQNAGRHIFVIGFSVGATIAWKCSSMPEV
FT                   SGSVCYYGSRIRDSLHHMPACPVLLFFPNYEPSFDVALLIKKLREKQHTHLEIYQFDAL
FT                   HGFANPDSVYFNRALFFKTLSIIKNGAESRLRTVSSSFF"
     MFPKPLVILA HEIYGVNSHM KKMGRLIKMA GYDVLTPNLL GEDEVYTLKE EKTAYEQFTK        60
     HERLKTGETI IQNVIRQNAG RHIFVIGFSV GATIAWKCSS MPEVSGSVCY YGSRIRDSLH       120
     HMPACPVLLF FPNYEPSFDV ALLIKKLREK QHTHLEIYQF DALHGFANPD SVYFNRALFF       180
     KTLSIIKNGA ESRLRTVSSS FF                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page