(data stored in ACNUC7421 zone)

EMBL: AL009126.YCZJ

AL009126.YCZJ        Location/Qualifiers
FT   CDS             complement(463496..463783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczJ"
FT                   /locus_tag="BSU_04130"
FT                   /old_locus_tag="BSU04130"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04130"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12220"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="SubtiList:BG12784"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31484"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12220.1"
FT                   /translation="MVREAAMLHIKEGLEQEFEDAFRQAAPIISGMKGYITHSLSKCME
FT                   ETHKYLLLVEWETLEDHTEGFRGSSEYQEWKALLHRFYTPFPTVEHFQDV"
     MVREAAMLHI KEGLEQEFED AFRQAAPIIS GMKGYITHSL SKCMEETHKY LLLVEWETLE        60
     DHTEGFRGSS EYQEWKALLH RFYTPFPTVE HFQDV                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page