(data stored in SCRATCH zone)

EMBL: AL009126.YCZK

AL009126.YCZK        Location/Qualifiers
FT   CDS             283816..283992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczK"
FT                   /locus_tag="BSU_02619"
FT                   /old_locus_tag="BSU02619"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02619"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52543"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3T2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52543.1"
FT                   /translation="MGGLQTTGYAENASFSQLSACFSSRLVREDLFLMFSAYNQFTLLH
FT                   SRLTMISYNGDDQ"
     MGGLQTTGYA ENASFSQLSA CFSSRLVRED LFLMFSAYNQ FTLLHSRLTM ISYNGDDQ          58
//

If you have problems or comments...

PBIL Back to PBIL home page