(data stored in ACNUC7421 zone)

EMBL: AL009126.YCZL

AL009126.YCZL        Location/Qualifiers
FT   CDS             365850..366035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczL"
FT                   /locus_tag="BSU_03359"
FT                   /old_locus_tag="BSU03359"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03359"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52544"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3U7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52544.1"
FT                   /translation="MKSGKASIKDLAVGKGKDLRWGKGLNAVGVFTDLEIGRQREMSAK
FT                   SCSTPLYIRRSIQFKS"
     MKSGKASIKD LAVGKGKDLR WGKGLNAVGV FTDLEIGRQR EMSAKSCSTP LYIRRSIQFK        60
     S                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page