(data stored in SCRATCH zone)

EMBL: AL009126.YDAC

AL009126.YDAC        Location/Qualifiers
FT   CDS             complement(470957..471502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaC"
FT                   /locus_tag="BSU_04180"
FT                   /old_locus_tag="BSU04180"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12225"
FT                   /db_xref="GOA:P96576"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="SubtiList:BG12051"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96576"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12225.1"
FT                   /translation="MIAGYIMAAENQTLNQWTINQLGITRGDSILEVGFGPGYCMQQML
FT                   KREKDVHLHGIDVSEAMLKLAARRVKPKGVRLIQGSIETFPLPASFYDKVISVNNYTIW
FT                   NDQTKGIKQIYRALKPGGKAAITMQPREADASPEKTKSFGRQMIADFKAAGFEDIDIQF
FT                   KNIKPELSVCATAKKPAT"
     MIAGYIMAAE NQTLNQWTIN QLGITRGDSI LEVGFGPGYC MQQMLKREKD VHLHGIDVSE        60
     AMLKLAARRV KPKGVRLIQG SIETFPLPAS FYDKVISVNN YTIWNDQTKG IKQIYRALKP       120
     GGKAAITMQP READASPEKT KSFGRQMIAD FKAAGFEDID IQFKNIKPEL SVCATAKKPA       180
     T                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page