(data stored in SCRATCH zone)

EMBL: AL009126.YDAD

AL009126.YDAD        Location/Qualifiers
FT   CDS             471709..472569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaD"
FT                   /locus_tag="BSU_04190"
FT                   /old_locus_tag="BSU04190"
FT                   /product="putative dehydrogenase"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10220166, 11948145,
FT                   15805528, 21520290, 28197687; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12226"
FT                   /db_xref="GOA:P80873"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="SubtiList:BG12052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80873"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12226.1"
FT                   /translation="MANYPKELPAQTQSRQPGIESEMNPSPVYEYEDYKGADKLKGKVA
FT                   LITGGDSGIGRAVSVAYAKEGADIAIVYKDEHEDAEETKKRVEQEGVKCLLIAGDVGEE
FT                   EFCNEAVEKTVKELGGLDILVNNAGEQHPKESIKDITSEQLHRTFKTNFYSQFYLTKKA
FT                   IDYLKPGSAIINTTSINPYVGNPTLIDYTATKGAINAFTRTMAQALVKDGIRVNAVAPG
FT                   PIWTPLIPATFPEETVAQFGQDTPMGRPGQPVEHVGCYVLLASDESSYMTGQTLHVNGG
FT                   NFVTT"
     MANYPKELPA QTQSRQPGIE SEMNPSPVYE YEDYKGADKL KGKVALITGG DSGIGRAVSV        60
     AYAKEGADIA IVYKDEHEDA EETKKRVEQE GVKCLLIAGD VGEEEFCNEA VEKTVKELGG       120
     LDILVNNAGE QHPKESIKDI TSEQLHRTFK TNFYSQFYLT KKAIDYLKPG SAIINTTSIN       180
     PYVGNPTLID YTATKGAINA FTRTMAQALV KDGIRVNAVA PGPIWTPLIP ATFPEETVAQ       240
     FGQDTPMGRP GQPVEHVGCY VLLASDESSY MTGQTLHVNG GNFVTT                      286
//

If you have problems or comments...

PBIL Back to PBIL home page