(data stored in SCRATCH zone)

EMBL: AL009126.YDAF

AL009126.YDAF        Location/Qualifiers
FT   CDS             473174..473725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaF"
FT                   /locus_tag="BSU_04210"
FT                   /old_locus_tag="BSU04210"
FT                   /product="putative ribosomal protein N-acetyltransferase"
FT                   /function="16.6: Maintain"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15468321; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04210"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12228"
FT                   /db_xref="GOA:P96579"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:1NSL"
FT                   /db_xref="SubtiList:BG12054"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96579"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12228.1"
FT                   /translation="MFTCKVNEHITIRLLEPKDAERLAELIIQNQQRLGKWLFFAENPS
FT                   SADTYRETIIPDWRRQYADLNGIEAGLLYDGSLCGMISLHNLDQVNRKAEIGYWIAKEF
FT                   EGKGIITAACRKLITYAFEELELNRVAICAAVGNEKSRAVPERIGFLEEGKARDGLYVN
FT                   GMHHDLVYYSLLKREWEGEK"
     MFTCKVNEHI TIRLLEPKDA ERLAELIIQN QQRLGKWLFF AENPSSADTY RETIIPDWRR        60
     QYADLNGIEA GLLYDGSLCG MISLHNLDQV NRKAEIGYWI AKEFEGKGII TAACRKLITY       120
     AFEELELNRV AICAAVGNEK SRAVPERIGF LEEGKARDGL YVNGMHHDLV YYSLLKREWE       180
     GEK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page