(data stored in ACNUC7421 zone)

EMBL: AL009126.YDAG

AL009126.YDAG        Location/Qualifiers
FT   CDS             473803..474225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaG"
FT                   /locus_tag="BSU_04220"
FT                   /old_locus_tag="BSU04220"
FT                   /product="putative general stress protein"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10220166; Product type
FT                   f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04220"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12229"
FT                   /db_xref="GOA:P80238"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="SubtiList:BG19017"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80238"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12229.1"
FT                   /translation="MNQQDIKQKVLDVLDHHKVGSLATVQKGKPHSRYMTFFHDGLTIY
FT                   TPTSKETHKAEEIENNPNVHILLGYDCEGFGDAYVEVAGKAKINNSAELKDKIWSSKLE
FT                   RWFDGKDDPNLVILEIEPEDIRLMNAGEKTPVSLEL"
     MNQQDIKQKV LDVLDHHKVG SLATVQKGKP HSRYMTFFHD GLTIYTPTSK ETHKAEEIEN        60
     NPNVHILLGY DCEGFGDAYV EVAGKAKINN SAELKDKIWS SKLERWFDGK DDPNLVILEI       120
     EPEDIRLMNA GEKTPVSLEL                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page