(data stored in ACNUC7421 zone)

EMBL: AL009126.YDAL

AL009126.YDAL        Location/Qualifiers
FT   CDS             480875..482584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaL"
FT                   /locus_tag="BSU_04290"
FT                   /old_locus_tag="BSU04290"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 27897378; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12236"
FT                   /db_xref="GOA:O31487"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="SubtiList:BG12059"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31487"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12236.1"
FT                   /translation="MLCVMMLLFSAIASFPVSAQAKDQDAGILIIYSTLDGKESSQVKM
FT                   LDLLAGHFTSHVTVKKDSDVEASDFKGKDHVIYYGQTKRKLSQKLLSLISGVKKPVVAI
FT                   GYNAGQISQFSGLSLARKENVFQVHSRSEKADVSLESGLNVLSVSGLKGTALYTFKADE
FT                   GTTHSFIWKTKKGNVYIGLTNLLNDNLIVAKQLREAFGEKAGTTLLYLRLEDISPMSDE
FT                   KLLLQAGTYLHKRHIPFILAVIPVYLNPETGDKVYLSNQPKMVKVLKKLQSMGGSIIVH
FT                   GYTHAYRYSETGEGFEFWDAKADQPITSGNAEDPPSILEKEQDFPNEQAYHSYLEPFRE
FT                   KEETYTKQKLTRAIEDLTSSGLYPLAFEAPHYTMSEYGYQIASQYFTSIFGQVQLSSTT
FT                   WKTSGAPPFVTAPSMLHGMTLYPETIGFVDTSKQNPLGEMEEHISQMIDFEGGVAGGFY
FT                   HPYLGMKYLPELVDQMERIPDSEWLDLKKTKQTVKTDKVEIHTSGDGTIQVKNGVSPIY
FT                   EFFDHHRQTPLEKALWILSAVVLLFVIMFVSYTFYLRATLKKRIFKERRSLG"
     MLCVMMLLFS AIASFPVSAQ AKDQDAGILI IYSTLDGKES SQVKMLDLLA GHFTSHVTVK        60
     KDSDVEASDF KGKDHVIYYG QTKRKLSQKL LSLISGVKKP VVAIGYNAGQ ISQFSGLSLA       120
     RKENVFQVHS RSEKADVSLE SGLNVLSVSG LKGTALYTFK ADEGTTHSFI WKTKKGNVYI       180
     GLTNLLNDNL IVAKQLREAF GEKAGTTLLY LRLEDISPMS DEKLLLQAGT YLHKRHIPFI       240
     LAVIPVYLNP ETGDKVYLSN QPKMVKVLKK LQSMGGSIIV HGYTHAYRYS ETGEGFEFWD       300
     AKADQPITSG NAEDPPSILE KEQDFPNEQA YHSYLEPFRE KEETYTKQKL TRAIEDLTSS       360
     GLYPLAFEAP HYTMSEYGYQ IASQYFTSIF GQVQLSSTTW KTSGAPPFVT APSMLHGMTL       420
     YPETIGFVDT SKQNPLGEME EHISQMIDFE GGVAGGFYHP YLGMKYLPEL VDQMERIPDS       480
     EWLDLKKTKQ TVKTDKVEIH TSGDGTIQVK NGVSPIYEFF DHHRQTPLEK ALWILSAVVL       540
     LFVIMFVSYT FYLRATLKKR IFKERRSLG                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page