(data stored in SCRATCH zone)

EMBL: AL009126.YDAM

AL009126.YDAM        Location/Qualifiers
FT   CDS             482577..483839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaM"
FT                   /locus_tag="BSU_04300"
FT                   /old_locus_tag="BSU04300"
FT                   /product="putative glycosyltransferase associated to
FT                   biofilm formation"
FT                   /EC_number="2.4.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 27897378, 28296273;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12237"
FT                   /db_xref="GOA:P96587"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="SubtiList:BG12060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96587"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12237.1"
FT                   /translation="MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENM
FT                   KELPKVSVLIPAHNEEVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEK
FT                   YDFIKMVITKPPNAGKGKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDE
FT                   KAGAVVGKFRVINAAKTLLTRFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSII
FT                   EKLGGWDDKALAEDTELTIRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQ
FT                   YVVLKFLAQFFKLKRKRIIFDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLA
FT                   MILWILAFFLFMTEVMITLSIEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKH
FT                   RLFKQEVKWYKTERYNQHKSG"
     MGNTLFFISL SLIWVMLLYH MFLMQGGFRH YMTFERNIPK WRENMKELPK VSVLIPAHNE        60
     EVVIRQTLKA MVNLYYPKDR LEIIVVNDNS SDRTGDIVNE FSEKYDFIKM VITKPPNAGK       120
     GKSSALNSGF AESNGDVICV YDADNTPEKM AVYYLVLGLM NDEKAGAVVG KFRVINAAKT       180
     LLTRFINIET ICFQWMAQGG RWKWFKIATI PGTNFAIRRS IIEKLGGWDD KALAEDTELT       240
     IRVYNLGYHI RFFPAAITWE QEPETWKVWW RQRTRWARGN QYVVLKFLAQ FFKLKRKRII       300
     FDLFYFFFTY FLFFFGVIMS NAIFVVNLFY DLHLSVGFLA MILWILAFFL FMTEVMITLS       360
     IEKTEMNKQN FFIVFLMYFT YSQAWIVLVI YSLFVEIKHR LFKQEVKWYK TERYNQHKSG       420
//

If you have problems or comments...

PBIL Back to PBIL home page