(data stored in SCRATCH zone)

EMBL: AL009126.YDAS

AL009126.YDAS        Location/Qualifiers
FT   CDS             complement(492654..492911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaS"
FT                   /locus_tag="BSU_04370"
FT                   /old_locus_tag="BSU04370"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04370"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12244"
FT                   /db_xref="GOA:P96594"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="SubtiList:BG12066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96594"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12244.1"
FT                   /translation="MLSFLVSLVVAIVIGLIGSAIVGNRLPGGIFGSMIAGLIGAWIGH
FT                   GLLGTWGPSLAGFAIFPAIIGAAIFVFLLGLIFRGLRKEA"
     MLSFLVSLVV AIVIGLIGSA IVGNRLPGGI FGSMIAGLIG AWIGHGLLGT WGPSLAGFAI        60
     FPAIIGAAIF VFLLGLIFRG LRKEA                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page