(data stored in ACNUC7421 zone)

EMBL: AL009126.YDAT

AL009126.YDAT        Location/Qualifiers
FT   CDS             complement(492989..493441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaT"
FT                   /locus_tag="BSU_04380"
FT                   /old_locus_tag="BSU04380"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12245"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="SubtiList:BG12067"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96595"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12245.1"
FT                   /translation="MPWSMKDYPASLKNLEKPVRKKAIDIANAMIDEGYEEGRAIPIAT
FT                   SKAKEWAENASTDEIDDFLTHDDETERDADPSSGSGPELMNKAEHVIKHKKGWAVKAEG
FT                   AKRVSEIKDTKKEAIERAKEIAAHKGTEVIVHLADGSVQRKIKTGS"
     MPWSMKDYPA SLKNLEKPVR KKAIDIANAM IDEGYEEGRA IPIATSKAKE WAENASTDEI        60
     DDFLTHDDET ERDADPSSGS GPELMNKAEH VIKHKKGWAV KAEGAKRVSE IKDTKKEAIE       120
     RAKEIAAHKG TEVIVHLADG SVQRKIKTGS                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page