(data stored in ACNUC7421 zone)

EMBL: AL009126.YDBA

AL009126.YDBA        Location/Qualifiers
FT   CDS             493559..494377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbA"
FT                   /locus_tag="BSU_04390"
FT                   /old_locus_tag="BSU04390"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04390"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12246"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="SubtiList:BG12068"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96596"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12246.1"
FT                   /translation="MPTERKEDLHQQLKEIEKWEKDQQKVWFWEKLSRLPFQLLDKLTP
FT                   EFIQKKIGKLLDEVGSFVQTGGQYLTSEKQIIRMFQKKLPEEIFESLEDIRKAPLPVMD
FT                   EIAEGMGKNRTNAATVQGATTGVGGVFTLAADIPAVLGLSLKTLQDIAVAYGYDPKEKK
FT                   ERVFIVKCLQLTSADVVGKRSILQELKHYDQDRTYKNVASQIQGWREVVLGYRDTFGWK
FT                   KLFQIVPVAGMVFGAAANRSTLNDITETGMMLYKKRRILERLKETEREME"
     MPTERKEDLH QQLKEIEKWE KDQQKVWFWE KLSRLPFQLL DKLTPEFIQK KIGKLLDEVG        60
     SFVQTGGQYL TSEKQIIRMF QKKLPEEIFE SLEDIRKAPL PVMDEIAEGM GKNRTNAATV       120
     QGATTGVGGV FTLAADIPAV LGLSLKTLQD IAVAYGYDPK EKKERVFIVK CLQLTSADVV       180
     GKRSILQELK HYDQDRTYKN VASQIQGWRE VVLGYRDTFG WKKLFQIVPV AGMVFGAAAN       240
     RSTLNDITET GMMLYKKRRI LERLKETERE ME                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page