(data stored in ACNUC7421 zone)

EMBL: AL009126.YDBB

AL009126.YDBB        Location/Qualifiers
FT   CDS             495009..495350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbB"
FT                   /locus_tag="BSU_04410"
FT                   /old_locus_tag="BSU04410"
FT                   /product="putative enzyme; cupin family"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10704478; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12248"
FT                   /db_xref="GOA:P96597"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR019780"
FT                   /db_xref="SubtiList:BG12069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96597"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12248.1"
FT                   /translation="MSKMQNLLAIANEVKEKHANFSISEVNDHCVRLAVFTGEYDWHHH
FT                   PDSDELFIVLEGELLIDFKDKETAVLKANDSLLIPKGTVHRTRSYVRTVNLCVEHKQAE
FT                   TVIIEEQPC"
     MSKMQNLLAI ANEVKEKHAN FSISEVNDHC VRLAVFTGEY DWHHHPDSDE LFIVLEGELL        60
     IDFKDKETAV LKANDSLLIP KGTVHRTRSY VRTVNLCVEH KQAETVIIEE QPC              113
//

If you have problems or comments...

PBIL Back to PBIL home page